La nutrition à son niveau supérieur

Lunasine et cancer du sein

lunasine et cancer du sein

Lunasine et cancer du sein

 

 Le cancer du sein est le cancer le plus fréquemment diagnostiqué et la principale cause de décès par cancer chez les femmes dans le monde (1). Dans la plupart des cas, c’est la métastase des cellules tumorales malignes, plutôt que la tumeur solide primaire, qui est la principale cause de décès. La métastase est un processus complexe impliquant l’adhésion cellulaire, la migration, l’invasion et la dégradation de la matrice extracellulaire (ECM). Par conséquent, il est urgent de développer des stratégies thérapeutiques et des agents ayant la capacité d’inhiber la croissance, la migration, l’invasion et la dégradation protéolytique de la ECM dans les cellules cancéreuses du sein.De nombreux peptides naturels contenant le motif RGD ont été examinés en tant qu’agents efficaces ayant une activité antitumorale et anti-métastatique (6). La lunasine est un peptide de 43 acides aminés originalement isolé à partir de graines de soja avec la séquence suivante: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD (7)

 

 

La Lunasine supprime la prolifération et la métastase du cancer du sein

Dans une étude démontrant pourquoi la lunasine est un ingrédient de santé révolutionnaire, des chercheurs chinois ont montré que la lunasine supprime la prolifération, la migration et l’invasion des récepteurs d’œstrogènes (er) positifs et er-négatifs des lignées cellulaires de cancer du sein.

L’effet inhibiteur de la lunasine sur la prolifération du cancer du sein et la métastase est attribué à :

1) la liaison compétitive du motif d’adhérence des cellules RGD de la lunasine aux récepteurs intégrine dans la membrane cellulaire, empêchant l’activation (phosphorylation) de la signalisation les voies (fak, SRC, Akt, Erk et NFkappaB) impliquées dans la prolifération et l’inflammation des cellules;

2)  la réduction de l’expression et de l’activité des gènes (MMP-2 et MMP-9) impliqués dans la migration et l’invasion des cellules cancéreuses du sein.

Résultats :

Figure 1: Effet cytotoxique de la lunasine sur les cellules cancéreuses du sein MCF-7 et MDA-MB-231

Figure 2 : La lunasine inhibe la migration et la motilité des cellules cancéreuses du sein in vitro

Figure 3 : La Lunasine inhibe l’invasion des cellules cancéreuses du sein

Figure 4 : La Lunasine réduit l’activité et l’expression de MMP-2 / -9 dans les cellules cancéreuses du sein

Figure 5 : La Lunasine supprime la phosphorylation de FAK et Src

Figure 6 : La lunasine supprime la phosphorylation de ERK et Akt

Figure 7 : La lunasine inactive le processus de translocation de NF-κB dans le noyau

Il y a accumulation de preuves montrant que la bioactivité de la lunasine est fortement associée à ses séquences peptidiques uniques .

Sources:

https://www.facebook.com/DrAlfredoGalvez/

https://www.spandidos-publications.com/or/36/1/253

 

 

Share this post



Laisser un commentaire

Votre adresse de messagerie ne sera pas publiée. Les champs obligatoires sont indiqués avec *